DPCstruct | MC59741
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 458 ± 92 aa |
| Standard deviation of domain lengths | 92.47 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 84.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R1WVY9 | 115-626 | MDKADARARETIAGQADLVGAIRLPEGSFRRDAGTDVVVDILFFRKRQAGKPEGDQTWLDIDEVRAATGEEGAIRVNRWFARHADFV… |
| U4Q3T5 | 4-334 | APDGTIHLRTADHIGQPTSQAVAFPNETAKERVSGMIRVRDAFAKLRRAQISETATDQQIENLRNRLNNLYDAFVKSHGPINSDANK… |
| A0A6D2C1Q0 | 21-400 | None |
| A0A256B867 | 28-382 | None |
| A0A358AQS6 | 118-483 | None |
| A0A6F9ZEE0 | 1-557 | None |
| A0A1Q6V0T9 | 1-295 | None |
| A0A380K0E4 | 2-274 | None |
| A0A510WSN3 | 38-489 | None |
| A0A8A4I3Z9 | 1-568 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.