DPCstruct | MC59740
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 112 ± 11 aa |
| Standard deviation of domain lengths | 11.32 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.63 |
| Pfam Score | 91.11 |
| Assigned Pfam label(s) | CL0036- PF16199 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7EUT8 | 5-104 | VRDTAELHPEFVKLHLLHVLSDTALSCMYRDGRYTPLTEEHYVSLVVSALELLPPDTVIARLTGDGMANSLEAPLWSTRKIAVINDI… |
| T0MW41 | 1-121 | MLGLPGDREDKDIQTTRRVIALKPSICRIYPSLVIKDTPMEEMLSKGIYKPYSLEQAVDISKKVYGMLSANGIQVIRIGLQPTEEIN… |
| T0D0T0 | 2-117 | None |
| A0A645J5N3 | 27-109 | None |
| A0A2B4SIX6 | 151-261 | None |
| A0A150NKV1 | 128-235 | None |
| A0A1R0GUE2 | 587-696 | None |
| A0A0F9C8J0 | 46-149 | None |
| A0A7J6RYK8 | 107-225 | None |
| A0A2J6XMG9 | 1-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.