DPCstruct | MC59734
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 509 ± 70 aa |
| Standard deviation of domain lengths | 70.11 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 14.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A317PV85 | 1-417 | MDIREQIMSTIAASKEAAAVPTGCKACERKGIPLFPLRVAAVPKGLVSSSWSPPVLPRPVELSGGEFKYALRTLRMGFLYVLLDKCA… |
| A0A7W3HCC0 | 1-502 | MSNEKGCKFCQRDGLPVLPVRPAIMEKGDALPALSGSITVPVTAEGGADYTARLLRQGFLYIWAERSQRWINYYATGDGYFYPLPED… |
| A0A2T3NU56 | 169-772 | None |
| B2PWG3 | 10-590 | None |
| A0A315WLW2 | 14-521 | None |
| A0A7Y1Q8U7 | 16-544 | None |
| A0A095SKM6 | 118-591 | None |
| A0A510US62 | 176-600 | None |
| A0A812FNF1 | 478-952 | None |
| A0A1I3QBD5 | 39-547 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.