DPCstruct | MC5973
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 170 ± 20 aa |
| Standard deviation of domain lengths | 20.25 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.68 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0023- CL0238 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W5M1W6 | 2-161 | MGTEEQAARSFLDELVKEFPGPLGPEQPLPVSPLSGTVSQAEIRGECLDVALRLLRARNAPEGLSAALSHAAVAELLKSDLSAFAQE… |
| L5LLJ7 | 1-214 | MASGAPEQSSQMAEETPSFLDEFLRDFPAPLSAESPLPWKIPGTVLSQEEVEGELAELAVSFLSSRNAPPPLAASLAHEAVAQLLQT… |
| S7NYN8 | 300-447 | None |
| A0A6G5AGB2 | 7-152 | None |
| A0A6P8UGU3 | 4-169 | None |
| A0A1S3PKE5 | 1-177 | None |
| A0A6J8DQL8 | 10-179 | None |
| T1IXX6 | 3-183 | None |
| A0A0L7LMA8 | 1-200 | None |
| H2ZPJ6 | 4-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.