DPCstruct | MC59726
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 110 ± 12 aa |
| Standard deviation of domain lengths | 12.20 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 47.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03985 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815LMR8 | 23-124 | PTNRLEREAKKHDRRSDIVCRVRYTNVLPDLPFDPKFLRYPFNQDRFVRYKPTSLEKNYRWDLLTEHDVGVEIDLINPDAYATTGQI… |
| A0A0N4YTH7 | 7-107 | FHRGPDFICKPRFRNTLPDVPFPGKFLPCPFVDLERFIDYKPTSLEMEYKYEVQCEMDIGLNLDLIDPLTYKVNPNNEIQINEKDAI… |
| A0A498L976 | 42-149 | None |
| A0A8B6C0K1 | 6-114 | None |
| A0A671LDX7 | 1-109 | None |
| A0A1R2CID3 | 1-121 | None |
| A0A177BCV8 | 1-109 | None |
| A0A820VNG6 | 243-325 | None |
| A0A2P8XD75 | 7-112 | None |
| A0A662WQ09 | 113-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.