DPCstruct | MC59723
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 430 ± 54 aa |
| Standard deviation of domain lengths | 54.28 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 26.82 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | PF19834- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815IRX7 | 2-385 | NDYLKLITDNGQESSKFINTNDEQPAFIAISDTYNEWNRAAPPINERPDWIFSLILNNGTTIETTCDDIIILCTGYRPCLDFFSQDI… |
| G1X362 | 62-483 | FIGISDTYMDHVRSGGIVISQGKLKSISGNIANLTPSGEQIDDIAAVVLATGFKASASLSFLSEDIQQKLSIAPNDLNNTVALAFHS… |
| A0A1L9TWB5 | 658-1107 | None |
| A0A0C9WNH9 | 172-537 | None |
| A0A0U5GVT7 | 98-532 | None |
| A0A507R2X9 | 644-1132 | None |
| A0A2T6ZVK7 | 42-608 | None |
| A0A6V8HJL3 | 762-1156 | None |
| A0A168G9R3 | 797-1273 | None |
| A0A7S4EPP4 | 279-733 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.