DPCstruct | MC59721
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 248 ± 39 aa |
| Standard deviation of domain lengths | 39.16 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N5A4V6 | 155-417 | FLVNNEMFEILMNQWKQCLDQNISLWNKKKIEYFYICGSLYTILFGPNEKIIMNGTTLNFRKKLKENGIFYDIHPSLTKLCGELSYE… |
| A0A815HQF2 | 5-215 | FFYMCTHTFNILFREDSSSQIVAIISPTTSGLRSALEREGIEFTMADGSSDSLNNSANKTNDDGEEDENGDENDATCVQWLEDIGLS… |
| A0A2K3NVM6 | 44-332 | None |
| A0A4W3I8D9 | 8-240 | None |
| A0A1Y3BIR0 | 108-409 | None |
| A0A7M5WXI6 | 247-443 | None |
| A0A5F5XSP0 | 308-556 | None |
| A0A3P8SXE1 | 232-477 | None |
| T1JCB0 | 261-522 | None |
| A0A453FPF2 | 2-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.