DPCstruct | MC5972
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 113 ± 7 aa |
| Standard deviation of domain lengths | 7.20 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 79.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 45.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19548 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5F4CFC9 | 200-309 | MPVYESVFMEDGETTRKIALETERPPQVEVHVWTIRKGILQHFHIEKISKRMFEELHHFKLVTRTTLSQWKIFTEGEAQISQMCSSR… |
| L5LCY3 | 1-110 | MPVYESVFMEDGETTRKIALETERPPQVEVHVWTIQKGILQHFHIEKISKRMFEELHHFKLVTRTTLSQWKIFTEGEAQISQMCSSR… |
| A0A6I9YEM9 | 332-443 | None |
| A0A7J8EIM9 | 269-378 | None |
| A0A6J0YBV9 | 415-524 | None |
| A0A7R8XBN4 | 384-514 | None |
| A0A835NDC7 | 185-297 | None |
| T1J447 | 314-418 | None |
| G3TK03 | 248-354 | None |
| A0A6J1Z204 | 487-596 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.