DPCstruct | MC59716
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 135 ± 17 aa |
| Standard deviation of domain lengths | 17.40 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 44.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04270 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L8GPW0 | 39-163 | RSVAYIDSKASQSQAKPSGAKTMDQISAEEGISAEQIVVKITDQGYVTSHGDHFHFYNGKVPYDAIVSEELLMTDPNYQLTPSDVIS… |
| A0A2X3RVS1 | 3-145 | KKAYLSLLTILLLFPLSACGFKAQDSTGKKLKSSHQLEKRCKALKKETDKSPNEVSKEEGIAAEQIVVSISDDGFVTSHGDHYHFYN… |
| A0A1T4N2P4 | 24-169 | None |
| G5KFV8 | 29-161 | None |
| G5KFV4 | 41-143 | None |
| A0A2Z5TT36 | 51-171 | None |
| A0A4V0EE03 | 29-135 | None |
| K1LNG5 | 23-158 | None |
| E4KPU7 | 1-149 | None |
| A0A4H9UBK6 | 1-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.