DPCstruct | MC59715
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 67 ± 8 aa |
| Standard deviation of domain lengths | 8.02 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 67.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T5ZV62 | 65-129 | MSDPDMIDGIIEAVSIPVMAKARIGHFAEAQVLQSLGVDYIDESEVLTPADYANHIDKWAFTVPF |
| A0A2J1DZ18 | 14-92 | GGVARMADPTIIEQIMKVVSIPVMAKCRIGHFVEAQILESMGVDYIDESEVLTPADENFHVWKHTLKSPSSAAAVIWAK |
| A0A2H9TPY4 | 1-64 | None |
| A0A5A7R3Q5 | 725-794 | None |
| A0A3F2S0I3 | 944-1013 | None |
| A0A484MVF9 | 677-745 | None |
| A0A834Z3B3 | 68-136 | None |
| A0A1Q9D7X5 | 329-392 | None |
| A0A1I8HAI7 | 457-526 | None |
| A0A1E5VQU1 | 14-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.