DPCstruct | MC59711
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 125 ± 21 aa |
| Standard deviation of domain lengths | 20.92 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 90.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 41.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0GI47 | 1-152 | MNRLDEDEKLQYSQINSCVEYPYNEKETKILHKLGAGFHGPKYELLEDGSGRPYSSIVNMRAAKIRNFLSVTEFDWVKQLLVVRYED… |
| A0A7S2E405 | 384-496 | HQPVYEMKNDGSGEPYDNILDMRADKIRNFLTVKDFKRITDFWVYKYEDLLADGTEEFLQKIEKATGVKRQCKAAEPQNRRKRPLDK… |
| B8BQL9 | 716-813 | None |
| A0A7S0G6T5 | 185-306 | None |
| K0RDY6 | 181-290 | None |
| A0A7S1VH07 | 5-117 | None |
| A0A7S1BVR7 | 1-164 | None |
| A0A7S1BA18 | 241-365 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.