DPCstruct | MC5971
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 91 ± 4 aa |
| Standard deviation of domain lengths | 4.27 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 56.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L5LBA4 | 1-85 | MGAWLAPVDVQREHDPRFDTEYKSRGCSNQYLVTHKQSLEDMLEKHQTLAREGRLCQQEVQLRLSYVYDWSAPPSQCCQRKEGIP |
| A0A341CMK1 | 63-152 | SEDVSLGAWLAPVDVQREHDPRFDTEYKSRGCNNQYLVTHKQSLEDMLEKHRTLAREGRLCKREVQLRLSYVYDWSAPPSQCCQRKE… |
| A0A0N5ALE0 | 641-733 | None |
| T1JN38 | 245-325 | None |
| A0A485NCW2 | 147-238 | None |
| A0A0N4WF95 | 889-983 | None |
| A0A044QPS7 | 452-542 | None |
| A0A2Y9E022 | 394-483 | None |
| A0A6A5HLS1 | 439-534 | None |
| A0A158PJC7 | 529-623 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.