DPCstruct | MC59708
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 405 ± 57 aa |
| Standard deviation of domain lengths | 57.04 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.21 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 21.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0GBQ7 | 1-385 | EDFPEAPDDLIELCDHAVISASEDAHQICEDACSVSTCCYDDADDSFVGFSLGECFNRNPFACVGYSPCMILYDDGKVPPPPLNLNE… |
| A0A7S0C434 | 7-293 | KNCRAYEACAVLIVLDAAPLELEVVCSEKSLATVSGSVECVEMCIPSSCCFDETSSCRLLNESQCKSWIACKNTPNSQNVYEDSPLA… |
| A0A7S4QRM4 | 158-595 | None |
| A0A7S1ZMX9 | 408-918 | None |
| B7G1S1 | 169-474 | None |
| A0A7S0CMP3 | 36-462 | None |
| A0A7S3V8F5 | 118-491 | None |
| B8CFE6 | 323-713 | None |
| A0A7R9WH75 | 12-486 | None |
| A0A7S1DA67 | 1-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.