DPCstruct | MC59705
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 114 ± 15 aa |
| Standard deviation of domain lengths | 15.12 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.53 |
| Pfam Score | 96.15 |
| Assigned Pfam label(s) | PF01915- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C1WH85 | 1-115 | MPLDRLPELWPKSLKNVALGAVLHPASISASLTHASDVLKSHDGTLFRLKALFGPQHGYLGQTQDNMIEWGGFTHPLWNIPVYSLYG… |
| A0A497KSN7 | 12-123 | EGKRTEVGAEVLLHESFNFIKGKRVGLVTNQTGVIGNLRHIADVLYEAPEVKLTALFGPEHGIRGDVQDALSIESYIDERTGLPVYS… |
| A0A0G9L938 | 13-116 | None |
| A0A7V3M396 | 196-299 | None |
| A0A117STS6 | 1-102 | None |
| A0A2V7KLY1 | 23-141 | None |
| A0A816VWF4 | 5-108 | None |
| A0A2V5WTP7 | 9-137 | None |
| A0A136N795 | 25-134 | None |
| A0A2L1TVC9 | 2-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.