DPCstruct | MC597
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 323 ± 43 aa |
| Standard deviation of domain lengths | 42.65 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 69.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C5YQ57 | 10-269 | LFAAAAQAVVVAPGSPCAASCGNVLDSTSSDDLVCSTGAYAGPTGQLFQGCIECELRSSFHNPERSDVYSMLYNLRYSLSYCLFGVP… |
| A0A1S9DAH4 | 260-596 | RAISYVHIMTYPLSRTTRILLLGLLALTYLFPPVHSLATIAKSKCIKSCGDTRKTSADDLVCPDSAYNNTQKGRTVKDCLLCQSTGT… |
| A0A0P7BLA6 | 3-352 | None |
| S3CUA4 | 3-381 | None |
| A0A3N2PXF0 | 1-301 | None |
| A0A4Q4VAJ5 | 12-277 | None |
| W2S1Y0 | 4-396 | None |
| A0A2J6PL88 | 2-359 | None |
| A0A2N3NKZ7 | 3-314 | None |
| A0A084QGY7 | 15-331 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.