DPCstruct | MC59695
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 178 ± 22 aa |
| Standard deviation of domain lengths | 21.74 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 35.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J0CU52 | 2-196 | SIFEPTTVRAILCAAEPTGKRSEFDSKWDAEVKKRCTAWASAEQKRISRLKVPQDVTAGDDDDSPNALSEQQLRWMAEVLEYVNYIH… |
| A0A4R0RVG5 | 251-463 | DVFEGNVVRAAIRATHQSKTEKLAFDEYWNKKTTGKSGHWGTSRATHTCVKEQLEFNSEVLHYVSLLAKATTVRSDVADSHPPETVP… |
| A0A4Y9ZLV6 | 55-198 | None |
| A0A0C9WMR3 | 10-189 | None |
| A0A1C7M163 | 2-184 | None |
| A0A1C7M0W6 | 126-301 | None |
| A0A1C7LRY6 | 6-135 | None |
| A0A401H2N6 | 2-181 | None |
| A0A0C9UYB0 | 7-202 | None |
| A0A4Y9ZZ41 | 2-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.