DPCstruct | MC5969
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 229 ± 50 aa |
| Standard deviation of domain lengths | 49.62 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 82.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 21.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G7EI10 | 20-233 | SAPGPDAVPAATPAPDPDQLLWGGATLLQQADTEPELCLGPVQESYPPQCGGPTVVGLDWDDVEGVERSAGVTWGSAYVVGTYDGST… |
| A0A255EI13 | 44-299 | QPTAYPGPAEPPPPPEEGAPLRIQGRAEFLQVDGEPVQLCFGPSPLMPGECGRSVPVEDFDWTAAPDVSEADGWRSALAKFTGLWDG… |
| A0A1H2CE33 | 18-284 | None |
| A0A3N2CTP4 | 1-176 | None |
| A0A7W1ZA53 | 42-348 | None |
| A0A255ESX1 | 2-213 | None |
| A0A0Q5AUI1 | 1-158 | None |
| A0A4T0UYV8 | 52-248 | None |
| A0A4Q2SBZ9 | 3-205 | None |
| A0A536DXN4 | 22-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.