DPCstruct | MC59673
Metacluster Properties and Pfam Annotations
| Number of structural domains | 100 |
|---|---|
| Mean domain length (aa) | 161 ± 31 aa |
| Standard deviation of domain lengths | 30.50 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.32 |
| Pfam Score | 97.44 |
| Assigned Pfam label(s) | CL0530- PF03169- CL0280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A256YFJ9 | 22-178 | KFLCDGMLGRIARWLRLLGYDTLYSSLSTDEELVKLAEKEERVLLTKDVELYRHALKSGIKVLLVEGNDFETMLAHIIKCFGILPKI… |
| A0A1C8ZRX1 | 3-145 | AQKFIVDAMLGRVARWLRIMGYDAIYSNKYEDWKILEIAQNQNRIIITRDRSIYTKSLRRHLKCILLSPDSDIVKDLAYIAYKTRID… |
| A0A812M4U0 | 13-168 | None |
| A0A2H6AY32 | 4-123 | None |
| A0A7J7IEX0 | 702-868 | None |
| A0A662X4K9 | 627-800 | None |
| A0A383WME5 | 249-436 | None |
| A0A0M8PRD7 | 98-244 | None |
| A0A7S0F6H9 | 148-292 | None |
| A0A135VJP7 | 2-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.