DPCstruct | MC5967
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 100 ± 9 aa |
| Standard deviation of domain lengths | 9.06 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C9XK85 | 1-92 | MLIYYIYQDPFIAWNYTKQREKIEGRFVPKEHFINAFFQSRYNLIKMKELYKENVTVNIFIKDFQNRDSHTLMAVDNVSFALPLTYT… |
| A0A7V1LF48 | 116-224 | KRSIKIDRSIYIYYLYLDPLAAWENTKAREYIDGRNILKTKFIEQYFKSQENVERIKQNFGNSVNIHCILKNSSNKVIDIKFNQPGV… |
| A0A2G2ANH1 | 18-105 | None |
| A0A4R3LPK9 | 2-83 | None |
| A0A5E7BI60 | 132-237 | None |
| A0A3A6TGL4 | 23-128 | None |
| A0A328XTN8 | 72-177 | None |
| A0A349MWY0 | 1-108 | None |
| A0A376H1B1 | 63-163 | None |
| A0A7C2BC44 | 82-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.