DPCstruct | MC59669
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 90 ± 7 aa |
| Standard deviation of domain lengths | 7.49 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y7DD01 | 2-89 | ALDGDAVASAVLTLVREQGLWRGTASELITYLRMLYPALTESAEAFPRQAAGFGAELRRVTPLLRAHGVEVTHLRKGKERKRLVCIAK |
| A0A412AZU1 | 23-103 | GYPVLTEAHPFLRKVTAFMERQTEWIGTVTDLLAAVGDKYTPPNTAARLLRKYDYDLLYKRCGMDVTFTRTNRKRLITLRK |
| A0A1V4UYA7 | 533-625 | None |
| A0A7Y3NXY6 | 186-268 | None |
| A0A0Q1CIR1 | 241-342 | None |
| N1ZFA2 | 1-83 | None |
| A0A1L5KFF1 | 59-140 | None |
| A0A5K7Z1M9 | 263-349 | None |
| A0A5N8YZF8 | 251-339 | None |
| A0A7J3TAZ3 | 458-554 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.