DPCstruct | MC59665
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 443 ± 74 aa |
| Standard deviation of domain lengths | 74.24 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.01 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0369- CL0036- CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7NHF0 | 2-451 | VHRFGGLQPAGAFPRSVIRRRLLPTLPHALFYDQTHDNESPAYKRTVFDYVPSAGLCAMSFCGTASVRGFDEMVPYMIDVVKETRVY… |
| T1GKN8 | 118-534 | LDSARKINPDLFVAAELFTNSDHTDNIFVNRLGITSLIREALSAWDSHEEGRLVYRYGGDPVGAFQISLQRPLKGAIAHALFLDLTH… |
| A0A0R3S651 | 1-403 | None |
| S9WDR6 | 293-612 | None |
| D8LWI1 | 82-655 | None |
| A0A0S7FT62 | 13-444 | None |
| A0A1U7LJZ3 | 209-713 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.