DPCstruct | MC59660
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 130 ± 13 aa |
| Standard deviation of domain lengths | 12.86 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 45.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7FDB7 | 1-132 | MWKQITQTYWSHTPTRAQGYSGLSIKVVNSTTGPGEHLRNALWHTGDTAGQVRTLWHDPKNIGWKDFTAYRWHLTHRPKTGLIRVIM… |
| A0A5E4A7W4 | 694-815 | SGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSVSGPGEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWQLLHRPQV… |
| A0A6J8B379 | 585-689 | None |
| A0A2I0TG19 | 228-361 | None |
| A0A3B4UYG0 | 1017-1153 | None |
| A0A7N8YC94 | 658-794 | None |
| A0A556TPZ3 | 233-350 | None |
| A0A7D9HBY4 | 837-964 | None |
| A0A7M5U9K6 | 868-1002 | None |
| A0A3R7MDZ9 | 340-463 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.