DPCstruct | MC5966
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 139 ± 35 aa |
| Standard deviation of domain lengths | 34.91 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 88.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 35.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05635 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G0HST6 | 1-117 | MQPYKKLYTYWFSVIIYDREVEFAEKWIKSWKLKEQMDGAARSGKQNIVEGSDDMDVSLKVAINLTGIAKGSLEELTGDLEDFLRQR… |
| A0A7V4MJD1 | 59-184 | KVIPSHGGYQKLKSYQSAEIVFDFTNHFCDKYIDYKSRTRDQMVQAARSGKQNIAEGSKNSGTSKMIELRLTEAARGSLEELLKDYE… |
| A0A5P8E5J8 | 3-96 | None |
| A0A0G0SRZ0 | 3-115 | None |
| A0A1V5ZA22 | 7-135 | None |
| A0A2E9IP19 | 15-113 | None |
| A0A1F8B1P0 | 3-129 | None |
| A0A0G1QSZ9 | 8-134 | None |
| A0A2N2PYY0 | 1-164 | None |
| A0A0G1I094 | 32-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.