DPCstruct | MC59658
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 200 ± 33 aa |
| Standard deviation of domain lengths | 32.93 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 66.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7F5K8 | 1-216 | MQVDVEKKDSDEEPMEMVVEKLDEPEAEADPEEKDVAPILTDKMAEDLKPMDTDKESLAESKSPEESIQEDSGSDIAPMQTDDQLKQ… |
| A0A817SCZ3 | 2-152 | DNSPQGMSPKSLISSLTTDEDCQEPLNGNLIGCSSSKTHIMECDHNANNIYLTIDDIRLLVELFYLPYQHGSNVQQVFMDFYWLRFN… |
| A0A833S617 | 1-217 | None |
| S9YED2 | 343-551 | None |
| A0A814JL10 | 604-760 | None |
| E9IQE5 | 137-360 | None |
| A0A818E907 | 715-873 | None |
| A0A3P7SL19 | 104-327 | None |
| A0A1B0GP85 | 14-242 | None |
| A0A3P8J9U9 | 94-336 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.