DPCstruct | MC59656
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 190 ± 24 aa |
| Standard deviation of domain lengths | 24.27 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 65.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.72 |
| Mean length-normalized TM-Score | 0.28 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0306 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7EHR4 | 1-187 | MSFVEDPACLSKSRLESDLVAHNVELPPAGSNKEAYVALHLRHVDQTNAADFSSDDDQEHNVAREDPEGEKELDPSALTDEDLKALL… |
| A0A814NZ87 | 1-207 | MALKAELHDKLKSLGYELGPFASKDTLSAVLCLHSVVMTQHNINVAKINDLELRRQLMENGLKVGPVTKHTRAIYQRKLLEVLTQQS… |
| Q5RGX4 | 1-203 | None |
| A0A0S7FAX4 | 3-165 | None |
| A0A7J6A5W0 | 1-224 | None |
| A0A7N6ANW3 | 21-173 | None |
| A0A210Q1F3 | 1-215 | None |
| A0A819EVI6 | 4-156 | None |
| A0A813WWX5 | 6-198 | None |
| A0A815VHK0 | 1-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.