DPCstruct | MC59655
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 257 ± 39 aa |
| Standard deviation of domain lengths | 38.61 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 50.86 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF08497- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090T6Q3 | 4-256 | RYTADKKLRHDDAYTPNNEGGKRPDRATLVYSQRCREAYKETPIVLGGIEASLRRIAHYDYWSDKVRRSVLFDAKADILLFGNAERA… |
| A0A7X7R224 | 100-305 | MVNHYTANKRLRSDDAYTPGGSHGFRPDYASLVYTKILKQLYPDVPVLLGGVEASMRRFSHYDYWSDSIKPSIIAESGADMLIYGMG… |
| A0A699GF14 | 424-727 | None |
| A0A2X1Q2S8 | 5-238 | None |
| A0A1Y0FZB2 | 109-436 | None |
| A0A7H4MSD9 | 1-190 | None |
| A0A6N6JQD3 | 278-526 | None |
| A0A7G3EUE4 | 1-256 | None |
| A0A6D0F2U5 | 81-339 | None |
| A0A812IR46 | 499-793 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.