DPCstruct | MC59654
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 603 ± 89 aa |
| Standard deviation of domain lengths | 89.18 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090T4H5 | 3-667 | ATLERLLVYSHVQTFYELFEDAFDVEITTEAGWVKVDHAQLVPMDEKQSADMGFALHIKLEPGFAAIKPTKPAKPIVKAESDPTLRL… |
| A0A257WCB1 | 446-942 | TVSEVTDLSIQNEGGILDPAKPIPLFGSTPKKGSVFYIGHTELEHKRITSLELTLTWQQYLGDLKTSVYDYKKNSVTSPYITGLANN… |
| A0A496DSJ4 | 28-687 | None |
| A0A6G3Z529 | 2-600 | None |
| A0A3D9ABB6 | 1-482 | None |
| A0A6L9Z845 | 714-1217 | None |
| A0A4R2PW48 | 221-645 | None |
| A0A4R6N980 | 573-1238 | None |
| A0A1C7PC93 | 376-1030 | None |
| A0A2X3J9I9 | 322-886 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.