DPCstruct | MC59650
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 82 ± 4 aa |
| Standard deviation of domain lengths | 4.31 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 46.34 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | PF08328- PF00206 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090S2S0 | 1-80 | MNREALLAELDQNWEVLAEPVQTVMRRYGIEKPYEKLKELTRGKRVDGEAMRNFIDGLELPEAEKARLKEMTPANYIGQA |
| K2DPL1 | 388-467 | KFRREILKKELDNHWEILSSLLQCMLRIQGDENPYDKIKKISRGLTWSKEDYIKAVKELPLNKQIKKKLYEFSPEKYSGE |
| A0A812P1I4 | 734-809 | None |
| A0A7Y4QFF4 | 72-148 | None |
| A0A2G8YE55 | 94-181 | None |
| A0A4S4EAQ2 | 444-528 | None |
| A0A2I0AB32 | 82-166 | None |
| A0A6P5TXS2 | 65-149 | None |
| A0A2J7ZZC1 | 253-337 | None |
| A0A258L726 | 250-328 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.