DPCstruct | MC59648
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 142 ± 18 aa |
| Standard deviation of domain lengths | 18.31 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 33.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7PCR1 | 1-140 | MGKWFKSGAPWIWMTGGAVSLSLVAVLGLLLLIGWRGLVYFWPHPIYEWQLEDANGNKSVLIGEINDRELVPVERLRAAGIPLEGEE… |
| A0A090S200 | 1-150 | MFKWLKSGAPWVWLTGGAVSISLISVLGLLLLIGWRGLTYFWPAPLYQWQDDNGSALIGQVYSKTWVPTYNIPNANELLPQEVLEAG… |
| A0A1B8NZB2 | 12-108 | None |
| A0A0M2UUU5 | 1-145 | None |
| A0A3S4H4J4 | 1-140 | None |
| A0A2D8SVW0 | 16-139 | None |
| A0A4Q9D1Y4 | 1-161 | None |
| A0A7C1FTH1 | 2-152 | None |
| A0A1W6U372 | 1-170 | None |
| A0A2S9SWR9 | 1-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.