DPCstruct | MC5964
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 161 ± 20 aa |
| Standard deviation of domain lengths | 19.74 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20461 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S8F0C1 | 4-154 | TQWLVDYIAKAFAGVSLDGGIDIHAAQSMDDYGNPEEDQLSKTAERIDWRRVKMATLQPRFWGITFLDAQGFRFYAPAIMTELLIQG… |
| A0A2D1IN22 | 17-159 | GYDLATIANAEETLCLWQAVKDIQTQIETAFSNVSLGDGIGLWEAQGVDDYKSLAERAALREKDEKSDWSKIPVQDLNDCNSSLGFF… |
| A0A517YSC7 | 6-182 | None |
| A0A2G6GTK9 | 1-143 | None |
| A0A350KJB7 | 131-294 | None |
| A0A3M8FW38 | 10-180 | None |
| A0A4Q3VB24 | 2-166 | None |
| A0A330L8Q3 | 4-169 | None |
| A0A4Q3VXN0 | 7-168 | None |
| M6QIE6 | 129-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.