DPCstruct | MC59636
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 112 ± 5 aa |
| Standard deviation of domain lengths | 5.32 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6RPG8 | 433-544 | IVNYDNRSSNIPVETLRLTAIKQLEQLQTIIVNDCTFIPFNTQIQIDATVDSGMLTDSIPFQSTYGRELWFCCHHAIHHFALIRVIC… |
| A0A520IGH3 | 48-162 | YQCLLSGYDAGMANYDNRKRDQLLETEPAAAIDSLQHISSTLEQPDKEITIQYQLNGSPLFIRSNYFREVYYNLEHSIHHHALIKVA… |
| A0A7V9PBI5 | 15-132 | None |
| A0A1S8VPH3 | 151-261 | None |
| A0A397V305 | 173-285 | None |
| A0A1V5P4L7 | 13-115 | None |
| A0A835ZF53 | 7-111 | None |
| A0A4U0W6E2 | 111-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.