DPCstruct | MC59635
Metacluster Properties and Pfam Annotations
| Number of structural domains | 157 |
|---|---|
| Mean domain length (aa) | 148 ± 27 aa |
| Standard deviation of domain lengths | 27.21 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 18.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F4SAS9 | 754-921 | GYNSMNDVDDDKEARDKISRANSRKRVSTLRAETFKKYFPDERQLHLIILDSRVHSEDELDKDNHQFRRKLPWRKEDFDTLLNLLGE… |
| A0A1Y2IMX7 | 10-149 | LFVTRQEVLTKKGWNQHLGLFARLKAEYMSGDETDRDEEGKKIHPPSYTIAEAEWQSRKFKGLMRKLEDWHNEEWRNPTIDGDYKGG… |
| A0A2N0R1S2 | 24-201 | None |
| A0A2H3D3I4 | 403-525 | None |
| A0A6P8HX37 | 36-175 | None |
| I1CG97 | 57-181 | None |
| A0A146H4H9 | 435-576 | None |
| A0A146HAD3 | 254-424 | None |
| A0A0C9U079 | 2-114 | None |
| A0A0C9UHS5 | 311-492 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.