DPCstruct | MC59624
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 142 ± 17 aa |
| Standard deviation of domain lengths | 16.77 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W5BXP0 | 1-149 | MKNDDLRAKIHTKVDELSDQRLSELWAFLANPQAPSTTKPIPTEPPGGQLYENRSDRAETAPEFIQRVYGEWLDGTFTRVDLRNLDA… |
| A0A255Z7P0 | 261-408 | QRIVDDLAGSVRHHLPHYSRLDQLLSQVQQALMEGTSGGGASPQADPDRLPDHAPMLYMDRVNRDQSIVEFMRDAWMPWIRSGLLTR… |
| T0J4Q5 | 1-125 | None |
| A0A1W2BYM8 | 182-346 | None |
| A0A2E4QTJ8 | 39-176 | None |
| A0A1W2AEG2 | 182-297 | None |
| A0A2S7K0M9 | 78-229 | None |
| A0A840YYB0 | 128-248 | None |
| A0A2A4XUB5 | 1-168 | None |
| A0A1N7NM49 | 185-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.