DPCstruct | MC59617
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 120 ± 14 aa |
| Standard deviation of domain lengths | 14.01 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06170 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838PFY7 | 5-117 | RPSFANLLRWCLLLRCPACGKASIVEAPFRIKDHCSSCRVVFQREQGFFVGAILVNVVTTEVVILLAYMASLQVINVHYQFVLVILF… |
| A0A5C8SJW3 | 7-119 | PQAPISTGLRGRCPRCGEGHLFKGFLTVAPSCEACGLDYGMFDSGDGPAFFVMSIVGIFVVGLALWMEITYQPPMWVHGLVAGSLSV… |
| A0A1H7BU91 | 24-136 | None |
| A0A2E7RY21 | 3-114 | None |
| A0A0C6FAQ1 | 834-981 | None |
| A0A3L7YIT2 | 3-128 | None |
| A0A258H093 | 17-137 | None |
| A0A378U400 | 69-189 | None |
| A0A368BHQ2 | 7-134 | None |
| A0A5C7NIZ0 | 169-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.