DPCstruct | MC59609
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 201 ± 34 aa |
| Standard deviation of domain lengths | 34.20 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03591 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F7FXA2 | 4-217 | SVAYSLIGASFGAIAVSGGLPLWVPVVMSLFVFAGASQFVTVGVIFAGGGAVAAVLAGLVLNARLLPFGFAVAGSFGSRWWSRLIGA… |
| A0A7X5WQL8 | 1-125 | ARPAGRALATHMVIDETTAMASVQSDDETAADAFWWTGVWLWSLWNLGSLGGALLGAVIGEPETWGLDAAFPAAFVALLAPHVTDAP… |
| A0A0L0KGG2 | 7-229 | None |
| U7UBH3 | 2-201 | None |
| A0A376FH16 | 3-128 | None |
| I7LF04 | 5-160 | None |
| A0A163LB40 | 188-418 | None |
| A0A3L7WS16 | 104-328 | None |
| A0A2E3TV63 | 85-316 | None |
| S3ZDP7 | 371-589 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.