DPCstruct | MC59608
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 108 ± 12 aa |
| Standard deviation of domain lengths | 11.69 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 16.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F7FX48 | 1-110 | MLGIRVRTEDGRSRDRLTAGELAALVRRIGGAGDRFVVVERLPDVPDVYVQVWHEEGGAYTLEHRDGDPERHFTTTVDAPGPVAKAL… |
| A0A661XKM0 | 32-137 | KMELMVLSNYSAEEKIISDSTTVDQIKNTMKGLNWNEFHQAILSTDNGNWIEVGGNLNEDGLSVMYEENGQQFVINKPPSSVDQMTK… |
| A0A1H9WKF9 | 11-148 | None |
| I0H8Q8 | 95-190 | None |
| A0A810LHV4 | 204-307 | None |
| A0A0M0FDP8 | 2-94 | None |
| A0A2V3PRS7 | 4-106 | None |
| A0A7J5BPT6 | 23-130 | None |
| A0A651EVK5 | 5-105 | None |
| A0A0M8Y411 | 2-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.