DPCstruct | MC59604
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 129 ± 17 aa |
| Standard deviation of domain lengths | 17.43 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19822 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7QTT0 | 7-95 | RRYTSYDLYGCFGALRAEFPEIQFLCKGSKLNVHPSSMSSQMSCGLVAYEMQQGKPAEDEDIVRIFDYEDRDLTNDIEEQKDFYRSW… |
| A0A0F7CNP4 | 177-305 | ETVSLLASDGCGRGEELQLTLSDHGPPFRVEVTRESGARTTYEGNTYGICLAKLQLDMEDEGLQLCCQGARPDTMSSSLLHASGGRH… |
| A0A2W1UFP8 | 2-137 | None |
| A0A7X0HH69 | 58-230 | None |
| A0A3N4YM24 | 247-379 | None |
| A0A3D2JD15 | 59-225 | None |
| X5DC28 | 11-147 | None |
| K0EVP5 | 90-223 | None |
| N1UB79 | 1-97 | None |
| A0A419YD85 | 7-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.