DPCstruct | MC59602
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 414 ± 63 aa |
| Standard deviation of domain lengths | 62.64 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P5YHP8 | 539-897 | LAPPPTAAGPVIDSEATCKVILGGRSGAKILSVKVRVEAAASFGAGFTTPVPAVVDAELATAAIWASTALPGVARCRFACTPVSEFP… |
| A0A7W7YE95 | 1-322 | MLKALNEVSRFSKLRHNGWPLGHVLEIGFDDKYVPKDGPSAAVACALLLEGSLTGKEWDPSFAVTGDMNSDGSVQPIGGVAAKIRGA… |
| A0A4Q2Y8V9 | 61-448 | None |
| A0A3M1JJK0 | 18-560 | None |
| B4D4G7 | 128-548 | None |
| A0A512M9I4 | 23-410 | None |
| F8ALT0 | 38-438 | None |
| A0A6G6K3S7 | 355-721 | None |
| N6VNY8 | 1-482 | None |
| A0A7C6XB60 | 9-474 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.