DPCstruct | MC59601
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 182 ± 29 aa |
| Standard deviation of domain lengths | 28.85 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0713 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W7YAR0 | 8-178 | SLQAAGVVLAADFAAGLVHWFEDAYVREDTPWLGRWLGRPNIVHHHLPRHMTHNTWWESNKELVMTMGMLIIAAAWLGCLTWHVWLF… |
| O81006 | 69-273 | WVAAGCTTVFVSFSKSIIGAFGSHLWLEPSLAGFAGYILADLGSGVYHWATDNYGDESTPLVGIHIEDSQDHHKCPWTITKRQFANN… |
| A0A7Y4ZPB9 | 27-233 | None |
| A0A5F8AD05 | 165-328 | None |
| A0A194PRT1 | 95-302 | None |
| A0A7S4EVX0 | 166-373 | None |
| A0A7S0DPI5 | 158-363 | None |
| A0A2P5BRV2 | 2-153 | None |
| A0A845TPM8 | 15-203 | None |
| A0A812TJJ1 | 367-565 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.