DPCstruct | MC596
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 180 ± 13 aa |
| Standard deviation of domain lengths | 13.38 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02325 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G0HI45 | 10-185 | TYLLHVLLDAYLYVIILRLVMQYVGVSYYNPAVNVCLILTNWAVKPLRKIAPGFKGVDFAIVLFWIVVAAVKVILLTWLDLDAGFPN… |
| A0A381PTD1 | 2-177 | LQAGFYIIKTLSQLFIMLFLLRLLFPWFHINYRNPAVQGIFRLTSSFINPIRRLIPPIGKIDTATLIVTFLIQYFVIFLLLILNQKM… |
| A0A6C1PIL1 | 50-243 | None |
| A0A316FFL5 | 5-178 | None |
| A0A378A9Z4 | 242-416 | None |
| A0A838S0Q3 | 2-192 | None |
| A0A521ZCD0 | 32-222 | None |
| A0A0F9MK91 | 5-181 | None |
| A3NYA1 | 15-213 | None |
| A0A0E1SA87 | 16-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.