DPCstruct | MC59596
Metacluster Properties and Pfam Annotations
| Number of structural domains | 846 |
|---|---|
| Mean domain length (aa) | 204 ± 35 aa |
| Standard deviation of domain lengths | 35.34 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.33 |
| Pfam Score | 98.16 |
| Assigned Pfam label(s) | CL0214- PF03647- PF00183- CL0207- CL0172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6WUM3 | 10-205 | TIGLIILMMLAFVMIAAQPTETQEHALNEFGFSKATFLEKPWTPITSIFLHADLVHLLSNILVLLFFGMAVESEMGDKKYLAIFFLA… |
| A0A378WKL1 | 12-173 | DWVLAPQFVAQGQWIRVLGSGFLHYGPLHLVVNMFALYILGRDTELVLGRSRFLAIYLVSLLGGSAAVMWLATDSATAGASGAIYGL… |
| A0A1S8VZ12 | 237-415 | None |
| A0A7H5EXS4 | 7-272 | None |
| A0A0D2PAY8 | 81-350 | None |
| A0A1S8VZN5 | 213-428 | None |
| A0A1Q9CB11 | 108-315 | None |
| A0A800M7Z5 | 21-230 | None |
| A0A2N5YTC8 | 4-128 | None |
| K6DRS8 | 18-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.