DPCstruct | MC59589
Metacluster Properties and Pfam Annotations
| Number of structural domains | 562 |
|---|---|
| Mean domain length (aa) | 185 ± 32 aa |
| Standard deviation of domain lengths | 31.89 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 13.76 |
| Pfam Score | 75.39 |
| Assigned Pfam label(s) | CL0023- CL0418- PF04860- PF10123- CL0201 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A837Q690 | 5-122 | DDDTVKVWGYASSEEIDSDGEVIAAAAMKAAIPDYMKFGAGREMHGSNAAGTAIEINVEDDGITFFGAHIIDPVVVSKVKTGVYKGF… |
| A0A2D6F062 | 28-215 | NNIKTTEIKTTEEKTDDQDYIKVEAYALTWGSKTNLDRGGDYISQDAFDEDLKDRGQMPMLFNHDNNTKSLGGYWDKFEKDDVGIKF… |
| A0A7T5JUX8 | 10-191 | None |
| A0A661QHF2 | 39-241 | None |
| A0A7V2AMN1 | 26-175 | None |
| A0A843FRJ4 | 11-222 | None |
| A0A7J9TI96 | 75-278 | None |
| A0A2I0CZ08 | 6-233 | None |
| A0A2S6XCQ5 | 11-258 | None |
| A0A7Y4ZT34 | 2-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.