DPCstruct | MC5958
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 142 ± 12 aa |
| Standard deviation of domain lengths | 12.43 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W1CZB9 | 104-228 | LKFIDANKAWYVVGSKKAGTMSKISKYAFAKKEDAETFAKKFTGEVKNFQETLKFVQDSLAKENGMIAKKQAMMAKKGKMMFENICK… |
| A0A7C3A3J8 | 1-161 | MDYAKKKFINTTDAFYLVGSKIPSHRSLISKVAFSTSEDAMDAYFKYGGYLVRYDDAFGLAVKHLADDDHKIEVLEAKCTEKGKALA… |
| A0A7C3R574 | 31-175 | None |
| A0A432SK42 | 86-212 | None |
| A0A7C3QSI2 | 1-127 | None |
| A0A1F9E6U1 | 89-243 | None |
| A0A7C2VUR1 | 115-270 | None |
| A0A7L8V3P3 | 103-244 | None |
| A0A2D3WGZ1 | 100-247 | None |
| Q7MSJ6 | 40-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.