DPCstruct | MC59573
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 365 ± 38 aa |
| Standard deviation of domain lengths | 37.52 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 26.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9JH32 | 1-400 | EHQSCVLGSARIVKHQLLEFLSPISLHHGANFVAAIAVAWQERRQAHYTKVIPVANPDQQVLVYLVGAIRAMPIDTLVQTVHQVVKQ… |
| A0A512UJL7 | 1-317 | MSNKLKFRSKKLLESLSELERQETLETILETNRPLSMKIKILHVLDSGHSQLSLPHILNSILTRCSPQVLSDKQKSTMYSSVTEKTL… |
| A0A6A4HWI0 | 2-305 | None |
| A0A0L0FW16 | 26-437 | None |
| A0A6G0J6R5 | 53-430 | None |
| A0A3B3Y5C1 | 1-380 | None |
| A0A669E576 | 722-1088 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.