DPCstruct | MC5957
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 61 ± 6 aa |
| Standard deviation of domain lengths | 5.54 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 46.77 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0063- CL0234 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W1DMD9 | 2-59 | LTIVVASVSVLGDLFESLFKRESGMKDSGQILPGHGGVLDRIDSLTAAAPFFLLGLNL |
| A0A7C2X9Q6 | 2-65 | GMGHAAAMGVLGSIFGQLGDLSESAVKRTFNVKDSGFLIPGHGGILDRLDSFIFMAPFVYYYKQ |
| A0A7C3VXU4 | 32-86 | None |
| A0A3D0W3A9 | 84-139 | None |
| A0A7X2SSQ2 | 135-197 | None |
| A0A645J9R6 | 17-80 | None |
| A0A7W1ZWI4 | 16-79 | None |
| A0A7I0JQD1 | 2-54 | None |
| A0A7S1DNX7 | 93-152 | None |
| A0A6J7N4H1 | 26-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.