DPCstruct | MC59564
Metacluster Properties and Pfam Annotations
| Number of structural domains | 298 |
|---|---|
| Mean domain length (aa) | 173 ± 32 aa |
| Standard deviation of domain lengths | 31.84 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 13.94 |
| Pfam Score | 32.05 |
| Assigned Pfam label(s) | PF20129- PF05936- PF20747- PF16075 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M0A316 | 3-179 | EIKRLNYFTSQFLVEKDFSDEQDYHRRMRHLHNRSLHTWGVVEGLEINKSGDKQVSVNNGMAIDSEGKEIVVLDEQPADIKTISLSE… |
| A0A166TZH6 | 7-145 | TFFSPSGSEYPITSDADAKLYMMLSGVDYTTFKRKNWTPMTSVGLTRTYTNTSFVVAGRYFELKNHMITLTPSTKSFVHVNIDLSTP… |
| A0A810LFT8 | 16-231 | None |
| A0A2W1V9Y8 | 4-147 | None |
| A0A4R1R5L2 | 5-153 | None |
| A0A2S1LTV3 | 8-152 | None |
| A0A538QBP2 | 2-172 | None |
| E9KSL3 | 144-333 | None |
| A0A396QEW2 | 1-124 | None |
| A0A7W5IHK9 | 3-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.