DPCstruct | MC5956
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 158 ± 34 aa |
| Standard deviation of domain lengths | 34.43 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 90.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12654 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V0MIE7 | 19-138 | GSKLTGNLINFRQIPDGHFYYSAFQKRATDPLCMTFGKNPKSLLECGIELGAIPSKYGDYSIRVSVLPRVPLILVVWKGDDEFPPEA… |
| A0A7C2W726 | 10-156 | ERKFELLDPPLSQNPPSVELQVALIIYLLNAQDIPLAGKWVQGKGLKGGVRFFASHPFPLEPLLERYGRDPEAFLERAFLLGGERER… |
| A0A3B9ZGV3 | 18-181 | None |
| A0A661NKW7 | 141-329 | None |
| C6LCZ9 | 45-260 | None |
| A0A7Y3XCC2 | 74-256 | None |
| A0A7C3AHT3 | 9-141 | None |
| A0A7V6GDG9 | 15-149 | None |
| A0A840URG7 | 26-203 | None |
| A0A7V3JPB5 | 104-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.