DPCstruct | MC59557
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 115 ± 10 aa |
| Standard deviation of domain lengths | 10.39 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A427H6Z8 | 4-119 | WFDNAAPDLREAVCASQNQLLHAQAALAKALKGLKQISEFAEPLLKGRLAEHGLDTPLLDTQLLRVEHDWHWLGLRHLYSHRRDSLL… |
| A0A1I3MNM9 | 57-165 | SAAQRQSLMDCIAASFTAQSTLDNAMSQLQDIDTFARPLLIKALKDQFKVELDVDKTYICLRKSVTMGVFNVTAGSFEALKLPLLQA… |
| A0A2H2YK71 | 51-160 | None |
| A0A2R7RAS3 | 359-484 | None |
| A0A2K9C7Q5 | 19-139 | None |
| A0A1H1RSJ2 | 46-163 | None |
| A0A7Y8DU14 | 40-133 | None |
| A0A5N7JPU7 | 1-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.