DPCstruct | MC5955
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 109 ± 11 aa |
| Standard deviation of domain lengths | 11.45 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 16.52 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | PF06877- PF05117 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I0HU55 | 8-108 | TGNVLADMAEAGVDLSVEHNVVYFHLFENKDDAQALAAHIETQYQEYQVTLKPDEIPNVWDVDCVVKQIPSYDNIVEQEQWFEKLSA… |
| A0A4S4G1D1 | 4-116 | ERTRRLAAQFAVDRAQIDNRRMLGDDVARPRDVEHFAYFPTADAAQRAVEQLEKAGFAGSTYFSADRSSLMAVRSDAVDEESARAFV… |
| A0A4R3YP77 | 1-83 | None |
| A0A2N2E6U4 | 216-309 | None |
| A0A0W1B551 | 130-237 | None |
| A0A1B6YQY9 | 2-101 | None |
| A0A6I4UF46 | 14-136 | None |
| A0A1H7UBD9 | 17-131 | None |
| A0A3P1S7E9 | 100-230 | None |
| A0A501XE09 | 13-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.