DPCstruct | MC59542
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 110 ± 19 aa |
| Standard deviation of domain lengths | 18.68 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 45.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183U7E0 | 2-121 | EEYYMKESVAKAMNMDAREADSLTSSMLDDVFFIVRKCVRRSLSSSSVDCVCAMLNNGVTALEDDFLQFIYAGIKAGYPSVGWTAEA… |
| A0A2G2X850 | 238-336 | EGYFMVENVRKAIKIDELVFDSLTTSMVDDVFYVLQSCFRRFISTSNINSVIAVLSNAVSLLGGEYNEALQQKIREPNPGAKLFTGG… |
| A0A438DQG6 | 1-103 | None |
| A0A7R9JKC6 | 321-427 | None |
| J9DX16 | 80-183 | None |
| A0A3P5ZYZ9 | 174-273 | None |
| V9IFY3 | 121-237 | None |
| A0A835LR26 | 3-94 | None |
| A0A183ELH5 | 55-215 | None |
| A0A078IZN6 | 98-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.